Lineage for d3nu7b_ (3nu7 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897748Species Pseudomonas aeruginosa [TaxId:287] [267859] (5 PDB entries)
  8. 2897766Domain d3nu7b_: 3nu7 B: [265086]
    automated match to d2ogaa_
    complexed with gol, pmp

Details for d3nu7b_

PDB Entry: 3nu7 (more details), 1.95 Å

PDB Description: WbpE, an Aminotransferase from Pseudomonas aeruginosa Involved in O-antigen Assembly in Complex with the Cofactor PMP
PDB Compounds: (B:) Aminotransferase WbpE

SCOPe Domain Sequences for d3nu7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nu7b_ c.67.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
miefidlknqqarikdkidagiqrvlrhgqyilgpevteledrladfvgakyciscangt
dalqivqmalgvgpgdevitpgftyvataetvallgakpvyvdidprtynldpqlleaai
tprtkaiipvslygqcadfdainaiaskygipviedaaqsfgasykgkrscnlstvacts
ffpskplgcygdggaiftnddelatairqiarhgqdrryhhirvgvnsrldtlqaaillp
kleifeeeialrqkvaaeydlslkqvgigtpfievnnisvyaqytvrmdnresvqaslka
agvptavhypiplnkqpavadekaklpvgdkaatqvmslpmhpyldtasikiicaaltn

SCOPe Domain Coordinates for d3nu7b_:

Click to download the PDB-style file with coordinates for d3nu7b_.
(The format of our PDB-style files is described here.)

Timeline for d3nu7b_: