SCOPe 2.08: Domain d3n9ui_: 3n9u I:

Lineage for d3n9ui_ (3n9u I:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries)

8. Domain d3n9ui_: 3n9u I: [265075]
   automated match to d4c7qa_
   protein/RNA complex; complexed with gol

Details for d3n9ui_

PDB Entry: 3n9u, 1.92 Å

PDB Description: Crystal Structure of the Complex between the 25 kDa Subunit and the 59 kDa Subunit (RRM domain) of Human Cleavage Factor Im

PDB Compounds: (I:) Cleavage and polyadenylation specificity factor subunit 7

SCOPe Domain Sequences for d3n9ui_:

Sequence, based on SEQRES records:

>d3n9ui_ d.58.7.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vyvgsfswwttdqqliqvirsigvydvvelkfaenrangqskgyaevvvasensvhklle
llpgkvlngekvdvrpatrqnlsqfeaqarkr

Sequence, based on observed residues (ATOM records):

>d3n9ui_ d.58.7.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vyvgsfswwttdqqliqvirsigvydvvelkfaenrangqskgyaevvvvhkllellpgk
vlngekvdvrpatrqnlsqfeaqarkr

Timeline for d3n9ui_:

• d3n9ui_ first appeared in SCOPe 2.05
  
• d3n9ui_ appears in SCOPe 2.07