Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries) |
Domain d3mbef2: 3mbe F:94-188 [265065] Other proteins in same PDB: d3mbed1, d3mbef1, d3mbef3 automated match to d2iadb1 complexed with nag |
PDB Entry: 3mbe (more details), 2.89 Å
SCOPe Domain Sequences for d3mbef2:
Sequence, based on SEQRES records: (download)
>d3mbef2 b.1.1.2 (F:94-188) automated matches {Mouse (Mus musculus) [TaxId: 10090]} rleqpnvaislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngd wtfqvlvmlemtphqgevytchvehpslkspitvew
>d3mbef2 b.1.1.2 (F:94-188) automated matches {Mouse (Mus musculus) [TaxId: 10090]} rleqpnvaislsrhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdwtfqvl vmlemtphqgevytchvehpslkspitvew
Timeline for d3mbef2: