Lineage for d3mbed1 (3mbe D:3-128)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1767233Domain d3mbed1: 3mbe D:3-128 [265062]
    Other proteins in same PDB: d3mbed2, d3mbef1, d3mbef2
    automated match to d3c5zb1
    complexed with nag

Details for d3mbed1

PDB Entry: 3mbe (more details), 2.89 Å

PDB Description: tcr 21.30 in complex with mhc class ii i-ag7hel(11-27)
PDB Compounds: (D:) TCR 21.3 beta chain

SCOPe Domain Sequences for d3mbed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mbed1 b.1.1.0 (D:3-128) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprskvavtggkvtlschqtnnhdymywyrqdtghglrlihysyvadstekgdipd
gykasrpsqenfslilelaslsqtavyfcasswdragntlyfgegsrlivve

SCOPe Domain Coordinates for d3mbed1:

Click to download the PDB-style file with coordinates for d3mbed1.
(The format of our PDB-style files is described here.)

Timeline for d3mbed1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mbed2