SCOP 1.59: Domain d1d4la_: 1d4l A:

Lineage for d1d4la_ (1d4l A:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (119 PDB entries)

8. Domain d1d4la_: 1d4l A: [26505]

Details for d1d4la_

PDB Entry: 1d4l, 1.75 Å

PDB Description: hiv-1 protease complexed with a macrocyclic peptidomimetic inhibitor

SCOP Domain Sequences for d1d4la_:

Sequence; same for both SEQRES and ATOM records:

>d1d4la_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
qipveixghkaigtvlvgptpvniigrnlltqigxtlnf

Timeline for d1d4la_:

• d1d4la_ first appeared (with stable ids) in SCOP 1.55
  
• d1d4la_ appears in SCOP 1.57
  
• d1d4la_ appears in SCOP 1.61
  
• d1d4la_ appears in the current release, SCOPe 2.08