Class b: All beta proteins [48724] (177 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) the barrel is decorated with additional structures |
Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins) barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel |
Protein Eukaryotic ornithine decarboxylase (ODC) [50625] (3 species) |
Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [50628] (5 PDB entries) Uniprot P07805 |
Domain d1qu4d1: 1qu4 D:35-43,D:284-411 [26500] Other proteins in same PDB: d1qu4a2, d1qu4b2, d1qu4c2, d1qu4d2 complexed with plp |
PDB Entry: 1qu4 (more details), 2.9 Å
SCOPe Domain Sequences for d1qu4d1:
Sequence, based on SEQRES records: (download)
>d1qu4d1 b.49.2.3 (D:35-43,D:284-411) Eukaryotic ornithine decarboxylase (ODC) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} degdpffvaXftlavnviakkvtpgvqtdvgahaesnaqsfmyyvndgvygsfncilydh avvrplpqrepipneklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvg tssfngfqsptiyyvvsg
>d1qu4d1 b.49.2.3 (D:35-43,D:284-411) Eukaryotic ornithine decarboxylase (ODC) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} degdpffvaXftlavnviakkvtpaqsfmyyvndgvygsfncilydhavvrplpqrepip neklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiy yvvsg
Timeline for d1qu4d1: