Lineage for d1f3td1 (1f3t D:14-43,D:284-409)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 803679Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 803786Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 803814Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins)
    barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel
  6. 803831Protein Eukaryotic ornithine decarboxylase (ODC) [50625] (3 species)
  7. 803837Species Trypanosoma brucei [TaxId:5691] [50628] (5 PDB entries)
    Uniprot P07805
  8. 803841Domain d1f3td1: 1f3t D:14-43,D:284-409 [26496]
    Other proteins in same PDB: d1f3ta2, d1f3tb2, d1f3tc2, d1f3td2
    complexed with plp, put

Details for d1f3td1

PDB Entry: 1f3t (more details), 2 Å

PDB Description: crystal structure of trypanosoma brucei ornithine decarboxylase (odc) complexed with putrescine, odc's reaction product.
PDB Compounds: (D:) ornithine decarboxylase

SCOP Domain Sequences for d1f3td1:

Sequence, based on SEQRES records: (download)

>d1f3td1 b.49.2.3 (D:14-43,D:284-409) Eukaryotic ornithine decarboxylase (ODC) {Trypanosoma brucei [TaxId: 5691]}
rflegfntrdalckkismntcdegdpffvaXftlavnviakkvtpgvqtdvgahaesnaq
sfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptcdgldqiveryyl
pemqvgewllfedmgaytvvgtssfngfqsptiyyvv

Sequence, based on observed residues (ATOM records): (download)

>d1f3td1 b.49.2.3 (D:14-43,D:284-409) Eukaryotic ornithine decarboxylase (ODC) {Trypanosoma brucei [TaxId: 5691]}
rflegfntrdalckkisgdpffvaXftlavnviakkvtqsfmyyvndgvygsfncilydh
avvrplpqrepipneklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvg
tssfngfqsptiyyvv

SCOP Domain Coordinates for d1f3td1:

Click to download the PDB-style file with coordinates for d1f3td1.
(The format of our PDB-style files is described here.)

Timeline for d1f3td1: