Class b: All beta proteins [48724] (174 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) the barrel is decorated with additional structures |
Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins) barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel |
Protein Eukaryotic ornithine decarboxylase (ODC) [50625] (3 species) |
Species Trypanosoma brucei [TaxId:5691] [50628] (5 PDB entries) Uniprot P07805 |
Domain d1f3td1: 1f3t D:14-43,D:284-409 [26496] Other proteins in same PDB: d1f3ta2, d1f3tb2, d1f3tc2, d1f3td2 complexed with plp, put |
PDB Entry: 1f3t (more details), 2 Å
SCOP Domain Sequences for d1f3td1:
Sequence, based on SEQRES records: (download)
>d1f3td1 b.49.2.3 (D:14-43,D:284-409) Eukaryotic ornithine decarboxylase (ODC) {Trypanosoma brucei [TaxId: 5691]} rflegfntrdalckkismntcdegdpffvaXftlavnviakkvtpgvqtdvgahaesnaq sfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptcdgldqiveryyl pemqvgewllfedmgaytvvgtssfngfqsptiyyvv
>d1f3td1 b.49.2.3 (D:14-43,D:284-409) Eukaryotic ornithine decarboxylase (ODC) {Trypanosoma brucei [TaxId: 5691]} rflegfntrdalckkisgdpffvaXftlavnviakkvtqsfmyyvndgvygsfncilydh avvrplpqrepipneklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvg tssfngfqsptiyyvv
Timeline for d1f3td1: