SCOP 1.57: Domain d1f3tc1: 1f3t C:14-43,C:284-409

Lineage for d1f3tc1 (1f3t C:14-43,C:284-409)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)

4. Superfamily b.49.2: Alanine racemase-like, C-terminal domain [50621] (1 family)

5. Family b.49.2.1: Alanine racemase-like, C-terminal domain [50622] (2 proteins)

6. Protein Eukaryotic ornithine decarboxylase [50625] (3 species)

7. Species Trypanosoma brucei [TaxId:5691] [50628] (3 PDB entries)

8. Domain d1f3tc1: 1f3t C:14-43,C:284-409 [26495]
   Other proteins in same PDB: d1f3ta2, d1f3tb2, d1f3tc2, d1f3td2

Details for d1f3tc1

PDB Entry: 1f3t, 2 Å

PDB Description: crystal structure of trypanosoma brucei ornithine decarboxylase (odc) complexed with putrescine, odc's reaction product.

SCOP Domain Sequences for d1f3tc1:

Sequence, based on SEQRES records:

>d1f3tc1 b.49.2.1 (C:14-43,C:284-409) Eukaryotic ornithine decarboxylase {Trypanosoma brucei}
rflegfntrdalckkismntcdegdpffvaXftlavnviakkvtpgvqtdvgahaesnaq
sfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptcdgldqiveryyl
pemqvgewllfedmgaytvvgtssfngfqsptiyyvv

Sequence, based on observed residues (ATOM records):

>d1f3tc1 b.49.2.1 (C:14-43,C:284-409) Eukaryotic ornithine decarboxylase {Trypanosoma brucei}
rflegfntrdalckkisgdpffvaXftlavnviakkvtqsfmyyvndgvygsfncilydh
avvrplpqrepipneklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvg
tssfngfqsptiyyvv

Timeline for d1f3tc1:

• d1f3tc1 first appeared (with stable ids) in SCOP 1.55
  
• d1f3tc1 appears in SCOP 1.59
  
• d1f3tc1 appears in the current release, SCOPe 2.08