![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
![]() | Protein Eukaryotic, cytoplasmic (80S ribosome functional complex) [267636] (5 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [268000] (2 PDB entries) Because SCOP is not case sensitive, we included upper case chains from 3j38 and 3j39 and lower case chains from 3j3a and 3j3b |
![]() | Domain d3j3bc_: 3j3b c: [264922] |
PDB Entry: 3j3b (more details), 5 Å
SCOPe Domain Sequences for d3j3bc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3j3bc_ i.1.1.1 (c:) Eukaryotic, cytoplasmic (80S ribosome functional complex) {Human (Homo sapiens) [TaxId: 9606]} slesinsrlqlvmksgkyvlgykqtlkmirqgkaklvilanncpalrkseieyyamlakt gvhhysgnnielgtacgkyyrvctlaiidpgdsdiirsmp
Timeline for d3j3bc_: