| Class b: All beta proteins [48724] (174 folds) |
| Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) ![]() the barrel is decorated with additional structures |
| Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins) barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel |
| Protein Eukaryotic ornithine decarboxylase (ODC) [50625] (3 species) |
| Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [50628] (5 PDB entries) Uniprot P07805 |
| Domain d2todd1: 2tod D:37-43,D:284-410 [26492] Other proteins in same PDB: d2toda2, d2todb2, d2todc2, d2todd2 complexed with dmo, plp; mutant |
PDB Entry: 2tod (more details), 2 Å
SCOPe Domain Sequences for d2todd1:
Sequence, based on SEQRES records: (download)
>d2todd1 b.49.2.3 (D:37-43,D:284-410) Eukaryotic ornithine decarboxylase (ODC) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
gdpffvaXftlavnviakkvtpgvqtdvgahaesnaqsfmyyvndgvygsfncilydhav
vrplpqrepipneklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvgts
sfngfqsptiyyvvs
>d2todd1 b.49.2.3 (D:37-43,D:284-410) Eukaryotic ornithine decarboxylase (ODC) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
gdpffvaXftlavnviakkvtpaqsfmyyvndgvygsfncilydhavvrplpqrepipne
klypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyv
vs
Timeline for d2todd1: