Lineage for d2todd1 (2tod D:37-43,D:284-410)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15612Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
  4. 15665Superfamily b.49.2: Alanine racemase-like, C-terminal domain [50621] (1 family) (S)
  5. 15666Family b.49.2.1: Alanine racemase-like, C-terminal domain [50622] (2 proteins)
  6. 15675Protein Eukaryotic ornithine decarboxylase [50625] (3 species)
  7. 15681Species Trypanosoma brucei [TaxId:5691] [50628] (3 PDB entries)
  8. 15685Domain d2todd1: 2tod D:37-43,D:284-410 [26492]
    Other proteins in same PDB: d2toda2, d2todb2, d2todc2, d2todd2

Details for d2todd1

PDB Entry: 2tod (more details), 2 Å

PDB Description: ornithine decarboxylase from trypanosoma brucei k69a mutant in complex with alpha-difluoromethylornithine

SCOP Domain Sequences for d2todd1:

Sequence, based on SEQRES records: (download)

>d2todd1 b.49.2.1 (D:37-43,D:284-410) Eukaryotic ornithine decarboxylase {Trypanosoma brucei}
gdpffvaXftlavnviakkvtpgvqtdvgahaesnaqsfmyyvndgvygsfncilydhav
vrplpqrepipneklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvgts
sfngfqsptiyyvvs

Sequence, based on observed residues (ATOM records): (download)

>d2todd1 b.49.2.1 (D:37-43,D:284-410) Eukaryotic ornithine decarboxylase {Trypanosoma brucei}
gdpffvaXftlavnviakkvtpaqsfmyyvndgvygsfncilydhavvrplpqrepipne
klypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyv
vs

SCOP Domain Coordinates for d2todd1:

Click to download the PDB-style file with coordinates for d2todd1.
(The format of our PDB-style files is described here.)

Timeline for d2todd1: