Lineage for d2todb1 (2tod B:37-43,B:284-410)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 61155Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
  4. 61223Superfamily b.49.2: Alanine racemase-like, C-terminal domain [50621] (1 family) (S)
  5. 61224Family b.49.2.1: Alanine racemase-like, C-terminal domain [50622] (2 proteins)
  6. 61233Protein Eukaryotic ornithine decarboxylase [50625] (3 species)
  7. 61239Species Trypanosoma brucei [TaxId:5691] [50628] (3 PDB entries)
  8. 61241Domain d2todb1: 2tod B:37-43,B:284-410 [26490]
    Other proteins in same PDB: d2toda2, d2todb2, d2todc2, d2todd2

Details for d2todb1

PDB Entry: 2tod (more details), 2 Å

PDB Description: ornithine decarboxylase from trypanosoma brucei k69a mutant in complex with alpha-difluoromethylornithine

SCOP Domain Sequences for d2todb1:

Sequence, based on SEQRES records: (download)

>d2todb1 b.49.2.1 (B:37-43,B:284-410) Eukaryotic ornithine decarboxylase {Trypanosoma brucei}
gdpffvaXftlavnviakkvtpgvqtdvgahaesnaqsfmyyvndgvygsfncilydhav
vrplpqrepipneklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvgts
sfngfqsptiyyvvs

Sequence, based on observed residues (ATOM records): (download)

>d2todb1 b.49.2.1 (B:37-43,B:284-410) Eukaryotic ornithine decarboxylase {Trypanosoma brucei}
gdpffvaXftlavnviakkvtaqsfmyyvndgvygsfncilydhavvrplpqrepipnek
lypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvv
s

SCOP Domain Coordinates for d2todb1:

Click to download the PDB-style file with coordinates for d2todb1.
(The format of our PDB-style files is described here.)

Timeline for d2todb1: