SCOPe 2.02: Domain d7odca1: 7odc A:2-43,A:284-418

Lineage for d7odca1 (7odc A:2-43,A:284-418)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families)
   the barrel is decorated with additional structures

5. Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins)
   barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel

6. Protein Eukaryotic ornithine decarboxylase (ODC) [50625] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [50627] (1 PDB entry)

8. Domain d7odca1: 7odc A:2-43,A:284-418 [26488]
   Other proteins in same PDB: d7odca2
   complexed with plp

Details for d7odca1

PDB Entry: 7odc, 1.6 Å

PDB Description: crystal structure ornithine decarboxylase from mouse, truncated 37 residues from the c-terminus, to 1.6 angstrom resolution

PDB Compounds: (A:) protein (ornithine decarboxylase)

SCOPe Domain Sequences for d7odca1:

Sequence, based on SEQRES records:

>d7odca1 b.49.2.3 (A:2-43,A:284-418) Eukaryotic ornithine decarboxylase (ODC) {Mouse (Mus musculus) [TaxId: 10090]}
ssftkdefdchildegftakdildqkinevsssddkdafyvaXftlavniiakktvwkeq
pgsddedesneqtfmyyvndgvygsfncilydhahvkallqkrpkpdekyysssiwgptc
dgldrivercnlpemhvgdwmlfenmgaytvaaastfngfqrpniyyvmsrpmwqlmk

Sequence, based on observed residues (ATOM records):

>d7odca1 b.49.2.3 (A:2-43,A:284-418) Eukaryotic ornithine decarboxylase (ODC) {Mouse (Mus musculus) [TaxId: 10090]}
ssftkdefdchildegftakdildqkindkdafyvaXftlavniiakktvweqtfmyyvn
dgvygsfncilydhahvkallqkrpkpdekyysssiwgptcdgldrivercnlpemhvgd
wmlfenmgaytvaaastfngfqrpniyyvmsrpmwqlmk

Timeline for d7odca1:

• d7odca1 first appeared (with stable ids) in SCOP 1.55
  
• d7odca1 appears in SCOPe 2.01
  
• d7odca1 appears in SCOPe 2.03
  
• d7odca1 appears in the current release, SCOPe 2.08