Lineage for d3j38m_ (3j38 M:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2647135Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2647916Protein Eukaryotic, cytoplasmic (80S ribosome functional complex) [267636] (5 species)
  7. 2648068Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [267999] (2 PDB entries)
    Because SCOP is not case sensitive, we included upper case chains from 3j38 and 3j39 and lower case chains from 3j3a and 3j3b
  8. 2648107Domain d3j38m_: 3j38 M: [264868]

Details for d3j38m_

PDB Entry: 3j38 (more details), 6 Å

PDB Description: Structure of the D. melanogaster 40S ribosomal proteins
PDB Compounds: (M:) 40s ribosomal protein s12

SCOPe Domain Sequences for d3j38m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3j38m_ i.1.1.1 (M:) Eukaryotic, cytoplasmic (80S ribosome functional complex) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
intalqevlkksliadglvhgihqackaldkrqavlcilaesfdepnykklvtalcnehq
iplirvdshkklgewsglckidkegkprkvcgcsvvvikdfgeetpaldvvkdhlrqns

SCOPe Domain Coordinates for d3j38m_:

Click to download the PDB-style file with coordinates for d3j38m_.
(The format of our PDB-style files is described here.)

Timeline for d3j38m_: