SCOP 1.61: Domain d2sfpb1: 2sfp B:3-11,B:245-381

Lineage for d2sfpb1 (2sfp B:3-11,B:245-381)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)

4. Superfamily b.49.2: Alanine racemase-like, C-terminal domain [50621] (1 family)

5. Family b.49.2.1: Alanine racemase-like, C-terminal domain [50622] (2 proteins)

6. Protein Alanine racemase [50623] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [50624] (5 PDB entries)

8. Domain d2sfpb1: 2sfp B:3-11,B:245-381 [26485]
   Other proteins in same PDB: d2sfpa2, d2sfpb2

Details for d2sfpb1

PDB Entry: 2sfp, 1.9 Å

PDB Description: alanine racemase with bound propionate inhibitor

SCOP Domain Sequences for d2sfpb1:

Sequence; same for both SEQRES and ATOM records:

>d2sfpb1 b.49.2.1 (B:3-11,B:245-381) Alanine racemase {Bacillus stearothermophilus}
dfhrdtwaeXfslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlqh
fhvlvdgqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletiny
evpctisyrvpriffrhkrimevrnai

Timeline for d2sfpb1:

• d2sfpb1 first appeared (with stable ids) in SCOP 1.55
  
• d2sfpb1 appears in SCOP 1.59
  
• d2sfpb1 appears in SCOP 1.63
  
• d2sfpb1 appears in the current release, SCOPe 2.08