Class b: All beta proteins [48724] (111 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies) |
Superfamily b.49.2: Alanine racemase-like, C-terminal domain [50621] (1 family) |
Family b.49.2.1: Alanine racemase-like, C-terminal domain [50622] (2 proteins) |
Protein Alanine racemase [50623] (1 species) |
Species Bacillus stearothermophilus [TaxId:1422] [50624] (5 PDB entries) |
Domain d2sfpb1: 2sfp B:3-11,B:245-381 [26485] Other proteins in same PDB: d2sfpa2, d2sfpb2 |
PDB Entry: 2sfp (more details), 1.9 Å
SCOP Domain Sequences for d2sfpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2sfpb1 b.49.2.1 (B:3-11,B:245-381) Alanine racemase {Bacillus stearothermophilus} dfhrdtwaeXfslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlqh fhvlvdgqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletiny evpctisyrvpriffrhkrimevrnai
Timeline for d2sfpb1: