![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
![]() | Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) ![]() the barrel is decorated with additional structures |
![]() | Family b.49.2.2: Alanine racemase [88682] (1 protein) |
![]() | Protein Alanine racemase [50623] (3 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [50624] (8 PDB entries) |
![]() | Domain d2sfpa1: 2sfp A:3-11,A:245-381 [26484] Other proteins in same PDB: d2sfpa2, d2sfpb2 complexed with plp, ppi |
PDB Entry: 2sfp (more details), 1.9 Å
SCOPe Domain Sequences for d2sfpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2sfpa1 b.49.2.2 (A:3-11,A:245-381) Alanine racemase {Bacillus stearothermophilus [TaxId: 1422]} dfhrdtwaeXfslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlqh fhvlvdgqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletiny evpctisyrvpriffrhkrimevrnai
Timeline for d2sfpa1: