Lineage for d2sfpa1 (2sfp A:3-11,A:245-381)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 671687Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 671787Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 671788Family b.49.2.2: Alanine racemase [88682] (1 protein)
  6. 671789Protein Alanine racemase [50623] (3 species)
  7. 671790Species Bacillus stearothermophilus [TaxId:1422] [50624] (8 PDB entries)
  8. 671799Domain d2sfpa1: 2sfp A:3-11,A:245-381 [26484]
    Other proteins in same PDB: d2sfpa2, d2sfpb2

Details for d2sfpa1

PDB Entry: 2sfp (more details), 1.9 Å

PDB Description: alanine racemase with bound propionate inhibitor
PDB Compounds: (A:) protein (alanine racemase)

SCOP Domain Sequences for d2sfpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2sfpa1 b.49.2.2 (A:3-11,A:245-381) Alanine racemase {Bacillus stearothermophilus [TaxId: 1422]}
dfhrdtwaeXfslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlqh
fhvlvdgqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletiny
evpctisyrvpriffrhkrimevrnai

SCOP Domain Coordinates for d2sfpa1:

Click to download the PDB-style file with coordinates for d2sfpa1.
(The format of our PDB-style files is described here.)

Timeline for d2sfpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2sfpa2