Lineage for d1sfta1 (1sft A:2-11,A:245-383)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1129800Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 1129907Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 1129908Family b.49.2.2: Alanine racemase [88682] (1 protein)
  6. 1129909Protein Alanine racemase [50623] (3 species)
  7. 1129910Species Bacillus stearothermophilus [TaxId:1422] [50624] (8 PDB entries)
  8. 1129913Domain d1sfta1: 1sft A:2-11,A:245-383 [26482]
    Other proteins in same PDB: d1sfta2, d1sftb2
    complexed with act, plp

Details for d1sfta1

PDB Entry: 1sft (more details), 1.9 Å

PDB Description: alanine racemase
PDB Compounds: (A:) alanine racemase

SCOPe Domain Sequences for d1sfta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfta1 b.49.2.2 (A:2-11,A:245-383) Alanine racemase {Bacillus stearothermophilus [TaxId: 1422]}
ndfhrdtwaeXfslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlq
hfhvlvdgqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletin
yevpctisyrvpriffrhkrimevrnaiga

SCOPe Domain Coordinates for d1sfta1:

Click to download the PDB-style file with coordinates for d1sfta1.
(The format of our PDB-style files is described here.)

Timeline for d1sfta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sfta2