SCOP 1.55: Domain d1sfta1: 1sft A:2-11,A:245-383

Lineage for d1sfta1 (1sft A:2-11,A:245-383)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)

4. Superfamily b.49.2: Alanine racemase-like, C-terminal domain [50621] (1 family)

5. Family b.49.2.1: Alanine racemase-like, C-terminal domain [50622] (2 proteins)

6. Protein Alanine racemase [50623] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [50624] (3 PDB entries)

8. Domain d1sfta1: 1sft A:2-11,A:245-383 [26482]
   Other proteins in same PDB: d1sfta2, d1sftb2

Details for d1sfta1

PDB Entry: 1sft, 1.9 Å

PDB Description: alanine racemase

SCOP Domain Sequences for d1sfta1:

Sequence; same for both SEQRES and ATOM records:

>d1sfta1 b.49.2.1 (A:2-11,A:245-383) Alanine racemase {Bacillus stearothermophilus}
ndfhrdtwaeXfslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlq
hfhvlvdgqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletin
yevpctisyrvpriffrhkrimevrnaiga

Timeline for d1sfta1:

• d1sfta1 appears in SCOP 1.57
  
• d1sfta1 appears in the current release, SCOPe 2.08