SCOPe 2.08: Domain d3gcxe1: 3gcx E:293-332

Lineage for d3gcxe1 (3gcx E:293-332)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.0: automated matches [227227] (1 protein)
   not a true family

6. Protein automated matches [226968] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225423] (30 PDB entries)

8. Domain d3gcxe1: 3gcx E:293-332 [264808]
   Other proteins in same PDB: d3gcxe2
   automated match to d2w2me_
   complexed with ca

Details for d3gcxe1

PDB Entry: 3gcx, 2.7 Å

PDB Description: pcsk9:egfa (ph 7.4)

PDB Compounds: (E:) low-density lipoprotein receptor

SCOPe Domain Sequences for d3gcxe1:

Sequence; same for both SEQRES and ATOM records:

>d3gcxe1 g.3.11.0 (E:293-332) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrce

Timeline for d3gcxe1:

• d3gcxe1 first appeared in SCOPe 2.05, called d3gcxe_
  
• d3gcxe1 appears in SCOPe 2.07