SCOP 1.75: Domain d1bd0a1: 1bd0 A:2-11,A:245-382

Lineage for d1bd0a1 (1bd0 A:2-11,A:245-382)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families)
   the barrel is decorated with additional structures

5. Family b.49.2.2: Alanine racemase [88682] (1 protein)

6. Protein Alanine racemase [50623] (3 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [50624] (8 PDB entries)

8. Domain d1bd0a1: 1bd0 A:2-11,A:245-382 [26480]
   Other proteins in same PDB: d1bd0a2, d1bd0b2

Details for d1bd0a1

PDB Entry: 1bd0, 1.6 Å

PDB Description: alanine racemase complexed with alanine phosphonate

PDB Compounds: (A:) alanine racemase

SCOP Domain Sequences for d1bd0a1:

Sequence; same for both SEQRES and ATOM records:

>d1bd0a1 b.49.2.2 (A:2-11,A:245-382) Alanine racemase {Bacillus stearothermophilus [TaxId: 1422]}
ndfhrdtwaeXfslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlq
hfhvlvdgqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletin
yevpctisyrvpriffrhkrimevrnaig

Timeline for d1bd0a1:

• d1bd0a1 first appeared (with stable ids) in SCOP 1.55
  
• d1bd0a1 appears in SCOP 1.73
  
• d1bd0a1 appears in SCOPe 2.01
  
• d1bd0a1 appears in the current release, SCOPe 2.08