![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
![]() | Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
![]() | Protein automated matches [226923] (78 species) not a true protein |
![]() | Species Oceanobacillus iheyensis [TaxId:182710] [255531] (3 PDB entries) |
![]() | Domain d3es8g2: 3es8 G:123-387 [264783] Other proteins in same PDB: d3es8a1, d3es8b1, d3es8c1, d3es8d1, d3es8e1, d3es8f1, d3es8g1, d3es8h1 automated match to d2oqya2 complexed with lmr, mg |
PDB Entry: 3es8 (more details), 2.2 Å
SCOPe Domain Sequences for d3es8g2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3es8g2 c.1.11.0 (G:123-387) automated matches {Oceanobacillus iheyensis [TaxId: 182710]} rvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvkee fgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktdyp isehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqelsv gtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgieldes llakyqvpdlswdnvtvhqlqdrta
Timeline for d3es8g2: