Class b: All beta proteins [48724] (174 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) automatically mapped to Pfam PF02874 |
Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species) |
Species Bacillus sp., strain ps3 [TaxId:1409] [88675] (1 PDB entry) |
Domain d1skyb2: 1sky B:21-95 [26478] Other proteins in same PDB: d1skyb1, d1skyb3, d1skye1, d1skye2, d1skye3 complexed with so4 |
PDB Entry: 1sky (more details), 3.2 Å
SCOPe Domain Sequences for d1skyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1skyb2 b.49.1.1 (B:21-95) F1 ATP synthase alpha subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} sqiqvsdvgtviqvgdgiarahgldnvmsgeavefanavmgmalnleennvgivilgpyt gikegdevrrtgrim
Timeline for d1skyb2: