![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (88 species) not a true protein |
![]() | Species Oceanobacillus iheyensis [TaxId:182710] [255530] (3 PDB entries) |
![]() | Domain d3es8c1: 3es8 C:1-122 [264774] Other proteins in same PDB: d3es8a2, d3es8b2, d3es8c2, d3es8d2, d3es8e2, d3es8f2, d3es8g2, d3es8h2 automated match to d2oqya1 complexed with lmr, mg |
PDB Entry: 3es8 (more details), 2.2 Å
SCOPe Domain Sequences for d3es8c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3es8c1 d.54.1.0 (C:1-122) automated matches {Oceanobacillus iheyensis [TaxId: 182710]} mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl gg
Timeline for d3es8c1: