SCOP 1.65: Domain d1efrf2: 1efr F:9-81

Lineage for d1efrf2 (1efr F:9-81)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family)

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
   6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)

6. Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88678] (10 PDB entries)

8. Domain d1efrf2: 1efr F:9-81 [26469]
   Other proteins in same PDB: d1efra1, d1efra2, d1efra3, d1efrb1, d1efrb2, d1efrb3, d1efrc1, d1efrc2, d1efrc3, d1efrd1, d1efrd3, d1efre1, d1efre3, d1efrf1, d1efrf3, d1efrg_
   complexed with adp, anp, app, bal, cpi, mg, tlx

Details for d1efrf2

PDB Entry: 1efr, 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the peptide antibiotic efrapeptin

SCOP Domain Sequences for d1efrf2:

Sequence; same for both SEQRES and ATOM records:

>d1efrf2 b.49.1.1 (F:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus)}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

Timeline for d1efrf2:

• d1efrf2 first appeared (with stable ids) in SCOP 1.55
  
• d1efrf2 appears in SCOP 1.63
  
• d1efrf2 appears in SCOP 1.67
  
• d1efrf2 appears in the current release, SCOPe 2.08