SCOPe 2.05: Domain d3ak2c1: 3ak2 C:1-92

Lineage for d3ak2c1 (3ak2 C:1-92)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (31 species)
   not a true protein

7. Species Aeropyrum pernix [TaxId:272557] [267821] (3 PDB entries)

8. Domain d3ak2c1: 3ak2 C:1-92 [264687]
   Other proteins in same PDB: d3ak2a2, d3ak2b2, d3ak2c2, d3ak2d2
   automated match to d1p7ga1
   complexed with edo, mn

Details for d3ak2c1

PDB Entry: 3ak2, 1.35 Å

PDB Description: Superoxide dismutase from Aeropyrum pernix K1, Mn-bound form

PDB Compounds: (C:) Superoxide dismutase [Mn/Fe]

SCOPe Domain Sequences for d3ak2c1:

Sequence; same for both SEQRES and ATOM records:

>d3ak2c1 a.2.11.0 (C:1-92) automated matches {Aeropyrum pernix [TaxId: 272557]}
mvsfkryelpplpynynalepyiieeimklhhqkhhntyvkganaalekiekhlkgeiqi
dvravmrdfsfnyaghimhtifwpnmappgkg

Timeline for d3ak2c1:

• d3ak2c1 is new in SCOPe 2.05-stable
  
• d3ak2c1 appears in SCOPe 2.06
  
• d3ak2c1 appears in the current release, SCOPe 2.08