SCOPe 2.05: Domain d3ak1d2: 3ak1 D:93-212

Lineage for d3ak1d2 (3ak1 D:93-212)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (30 species)
   not a true protein

7. Species Aeropyrum pernix [TaxId:272557] [267822] (3 PDB entries)

8. Domain d3ak1d2: 3ak1 D:93-212 [264682]
   Other proteins in same PDB: d3ak1a1, d3ak1b1, d3ak1c1, d3ak1d1
   automated match to d1p7ga2
   complexed with edo

Details for d3ak1d2

PDB Entry: 3ak1, 1.57 Å

PDB Description: Superoxide dismutase from Aeropyrum pernix K1, apo-form

PDB Compounds: (D:) Superoxide dismutase [Mn/Fe]

SCOPe Domain Sequences for d3ak1d2:

Sequence; same for both SEQRES and ATOM records:

>d3ak1d2 d.44.1.0 (D:93-212) automated matches {Aeropyrum pernix [TaxId: 272557]}
ggtpggrvadliekqfggfekfkalfsaaaktvegvgwgvlafdplteelrilqvekhnv
lmtaglvpilvidvwehayylqykndrgsyvenwwnvvnwddvekrleqalnnakplyll

Timeline for d3ak1d2:

• d3ak1d2 is new in SCOPe 2.05-stable
  
• d3ak1d2 appears in SCOPe 2.06
  
• d3ak1d2 appears in the current release, SCOPe 2.08