Lineage for d3ak1b2 (3ak1 B:93-213)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946299Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2946300Protein automated matches [226860] (38 species)
    not a true protein
  7. 2946316Species Aeropyrum pernix [TaxId:272557] [267822] (3 PDB entries)
  8. 2946326Domain d3ak1b2: 3ak1 B:93-213 [264678]
    Other proteins in same PDB: d3ak1a1, d3ak1b1, d3ak1c1, d3ak1d1
    automated match to d1p7ga2
    complexed with edo

Details for d3ak1b2

PDB Entry: 3ak1 (more details), 1.57 Å

PDB Description: Superoxide dismutase from Aeropyrum pernix K1, apo-form
PDB Compounds: (B:) Superoxide dismutase [Mn/Fe]

SCOPe Domain Sequences for d3ak1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ak1b2 d.44.1.0 (B:93-213) automated matches {Aeropyrum pernix [TaxId: 272557]}
ggtpggrvadliekqfggfekfkalfsaaaktvegvgwgvlafdplteelrilqvekhnv
lmtaglvpilvidvwehayylqykndrgsyvenwwnvvnwddvekrleqalnnakplyll
p

SCOPe Domain Coordinates for d3ak1b2:

Click to download the PDB-style file with coordinates for d3ak1b2.
(The format of our PDB-style files is described here.)

Timeline for d3ak1b2: