SCOPe 2.07: Domain d3a0hz_: 3a0h Z:

Lineage for d3a0hz_ (3a0h Z:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.5: PsbZ-like [161055] (2 families)
   automatically mapped to Pfam PF01737

5. Family f.17.5.1: PsbZ-like [161056] (1 protein)
   Pfam PF01737; Ycf9

6. Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [192451] (30 PDB entries)

8. Domain d3a0hz_: 3a0h Z: [264659]
   Other proteins in same PDB: d3a0ha_, d3a0hb_, d3a0hc_, d3a0hd_, d3a0he_, d3a0hf_, d3a0hh_, d3a0hi_, d3a0hj_, d3a0hk_, d3a0hl_, d3a0hm_, d3a0hn_, d3a0ho_, d3a0ht_, d3a0hu_, d3a0hv_, d3a0hx_, d3a0hy_
   complexed with bcr, cla, dgd, fe2, hem, iod, lhg, mge, oec, pho, pq9

Details for d3a0hz_

PDB Entry: 3a0h, 4 Å

PDB Description: Crystal structure of I-substituted Photosystem II complex

PDB Compounds: (Z:) Photosystem II reaction center protein Z

SCOPe Domain Sequences for d3a0hz_:

Sequence; same for both SEQRES and ATOM records:

>d3a0hz_ f.17.5.1 (Z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus vulcanus [TaxId: 32053]}
mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
vv

Timeline for d3a0hz_:

• d3a0hz_ first appeared in SCOPe 2.05
  
• d3a0hz_ appears in SCOPe 2.06
  
• d3a0hz_ appears in the current release, SCOPe 2.08