Lineage for d3a0hz_ (3a0h Z:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252855Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2253087Superfamily f.17.5: PsbZ-like [161055] (1 family) (S)
    automatically mapped to Pfam PF01737
  5. 2253088Family f.17.5.1: PsbZ-like [161056] (1 protein)
    Pfam PF01737; Ycf9
  6. 2253089Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species)
  7. 2253099Species Thermosynechococcus vulcanus [TaxId:32053] [192451] (12 PDB entries)
  8. 2253111Domain d3a0hz_: 3a0h Z: [264659]
    Other proteins in same PDB: d3a0ha_, d3a0hb_, d3a0hc_, d3a0hd_, d3a0he_, d3a0hf_, d3a0hh_, d3a0hi_, d3a0hj_, d3a0hk_, d3a0hl_, d3a0hm_, d3a0hn_, d3a0ho_, d3a0ht_, d3a0hu_, d3a0hv_, d3a0hx_, d3a0hy_
    complexed with bcr, cla, dgd, fe2, hem, iod, lhg, mge, oec, pho, pq9

Details for d3a0hz_

PDB Entry: 3a0h (more details), 4 Å

PDB Description: Crystal structure of I-substituted Photosystem II complex
PDB Compounds: (Z:) Photosystem II reaction center protein Z

SCOPe Domain Sequences for d3a0hz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a0hz_ f.17.5.1 (Z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus vulcanus [TaxId: 32053]}
mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
vv

SCOPe Domain Coordinates for d3a0hz_:

Click to download the PDB-style file with coordinates for d3a0hz_.
(The format of our PDB-style files is described here.)

Timeline for d3a0hz_: