Lineage for d3a0hx_ (3a0h X:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2255005Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) (S)
    Pfam PF06596
  5. 2255006Family f.23.40.1: PsbX-like [267615] (2 proteins)
  6. 2255007Protein Photosystem II reaction center protein X, PsbX [267653] (1 species)
  7. 2255008Species Thermosynechococcus vulcanus [TaxId:32053] [267728] (1 PDB entry)
  8. 2255009Domain d3a0hx_: 3a0h X: [264657]
    Other proteins in same PDB: d3a0ha_, d3a0hb_, d3a0hc_, d3a0hd_, d3a0he_, d3a0hf_, d3a0hh_, d3a0hi_, d3a0hj_, d3a0hk_, d3a0hl_, d3a0hm_, d3a0hn_, d3a0ho_, d3a0ht_, d3a0hu_, d3a0hv_, d3a0hy_, d3a0hz_
    complexed with bcr, cla, dgd, fe2, hem, iod, lhg, mge, oec, pho, pq9

Details for d3a0hx_

PDB Entry: 3a0h (more details), 4 Å

PDB Description: Crystal structure of I-substituted Photosystem II complex
PDB Compounds: (X:) Photosystem II reaction center protein X

SCOPe Domain Sequences for d3a0hx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a0hx_ f.23.40.1 (X:) Photosystem II reaction center protein X, PsbX {Thermosynechococcus vulcanus [TaxId: 32053]}
titpslkgffigllsgavvlgltfavliaisqid

SCOPe Domain Coordinates for d3a0hx_:

Click to download the PDB-style file with coordinates for d3a0hx_.
(The format of our PDB-style files is described here.)

Timeline for d3a0hx_: