SCOPe 2.06: Domain d3a0hx_: 3a0h X:

Lineage for d3a0hx_ (3a0h X:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family)
   Pfam PF06596

5. Family f.23.40.1: PsbX-like [267615] (2 proteins)

6. Protein Photosystem II reaction center protein X, PsbX [267653] (1 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [267728] (1 PDB entry)

8. Domain d3a0hx_: 3a0h X: [264657]
   Other proteins in same PDB: d3a0ha_, d3a0hb_, d3a0hc_, d3a0hd_, d3a0he_, d3a0hf_, d3a0hh_, d3a0hi_, d3a0hj_, d3a0hk_, d3a0hl_, d3a0hm_, d3a0hn_, d3a0ho_, d3a0ht_, d3a0hu_, d3a0hv_, d3a0hy_, d3a0hz_
   complexed with bcr, cla, dgd, fe2, hem, iod, lhg, mge, oec, pho, pq9

Details for d3a0hx_

PDB Entry: 3a0h, 4 Å

PDB Description: Crystal structure of I-substituted Photosystem II complex

PDB Compounds: (X:) Photosystem II reaction center protein X

SCOPe Domain Sequences for d3a0hx_:

Sequence; same for both SEQRES and ATOM records:

>d3a0hx_ f.23.40.1 (X:) Photosystem II reaction center protein X, PsbX {Thermosynechococcus vulcanus [TaxId: 32053]}
titpslkgffigllsgavvlgltfavliaisqid

Timeline for d3a0hx_:

• d3a0hx_ first appeared in SCOPe 2.05
  
• d3a0hx_ appears in SCOPe 2.07
  
• d3a0hx_ appears in the current release, SCOPe 2.08