Lineage for d3a0ht_ (3a0h T:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631879Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family) (S)
    automatically mapped to Pfam PF01405
  5. 2631880Family f.23.34.1: PsbT-like [161030] (2 proteins)
    Pfam PF01405
  6. 2631881Protein Photosystem II reaction center protein T, PsbT [161031] (3 species)
  7. 2631896Species Thermosynechococcus vulcanus [TaxId:32053] [224949] (23 PDB entries)
  8. 2631919Domain d3a0ht_: 3a0h T: [264654]
    Other proteins in same PDB: d3a0ha_, d3a0hb_, d3a0hc_, d3a0hd_, d3a0he_, d3a0hf_, d3a0hh_, d3a0hi_, d3a0hj_, d3a0hk_, d3a0hl_, d3a0hm_, d3a0hn_, d3a0ho_, d3a0hu_, d3a0hv_, d3a0hx_, d3a0hy_, d3a0hz_
    complexed with bcr, cla, dgd, fe2, hem, iod, lhg, mge, oec, pho, pq9

Details for d3a0ht_

PDB Entry: 3a0h (more details), 4 Å

PDB Description: Crystal structure of I-substituted Photosystem II complex
PDB Compounds: (T:) Photosystem II reaction center protein T

SCOPe Domain Sequences for d3a0ht_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a0ht_ f.23.34.1 (T:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus vulcanus [TaxId: 32053]}
metityvfifaciialfffaiffrepprit

SCOPe Domain Coordinates for d3a0ht_:

Click to download the PDB-style file with coordinates for d3a0ht_.
(The format of our PDB-style files is described here.)

Timeline for d3a0ht_: