![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family) ![]() automatically mapped to Pfam PF01405 |
![]() | Family f.23.34.1: PsbT-like [161030] (2 proteins) Pfam PF01405 |
![]() | Protein Photosystem II reaction center protein T, PsbT [161031] (3 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [224949] (23 PDB entries) |
![]() | Domain d3a0ht_: 3a0h T: [264654] Other proteins in same PDB: d3a0ha_, d3a0hb_, d3a0hc_, d3a0hd_, d3a0he_, d3a0hf_, d3a0hh_, d3a0hi_, d3a0hj_, d3a0hk_, d3a0hl_, d3a0hm_, d3a0hn_, d3a0ho_, d3a0hu_, d3a0hv_, d3a0hx_, d3a0hy_, d3a0hz_ complexed with bcr, cla, dgd, fe2, hem, iod, lhg, mge, oec, pho, pq9 |
PDB Entry: 3a0h (more details), 4 Å
SCOPe Domain Sequences for d3a0ht_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a0ht_ f.23.34.1 (T:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus vulcanus [TaxId: 32053]} metityvfifaciialfffaiffrepprit
Timeline for d3a0ht_: