| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) |
Superfamily f.4.1: OMPA-like [56925] (5 families) ![]() forms (8,10) barrel |
| Family f.4.1.4: PsbO-like [161115] (2 proteins) Pfam PF01716; MSP |
| Protein Manganese-stabilising protein, PsbO [161116] (2 species) |
| Species Thermosynechococcus vulcanus [TaxId:32053] [189919] (27 PDB entries) |
| Domain d3a0ho_: 3a0h O: [264653] Other proteins in same PDB: d3a0ha_, d3a0hb_, d3a0hc_, d3a0hd_, d3a0he_, d3a0hf_, d3a0hh_, d3a0hi_, d3a0hj_, d3a0hk_, d3a0hl_, d3a0hm_, d3a0hn_, d3a0ht_, d3a0hu_, d3a0hv_, d3a0hx_, d3a0hy_, d3a0hz_ complexed with bcr, cla, dgd, fe2, hem, iod, lhg, mge, oec, pho, pq9 |
PDB Entry: 3a0h (more details), 4 Å
SCOPe Domain Sequences for d3a0ho_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a0ho_ f.4.1.4 (O:) Manganese-stabilising protein, PsbO {Thermosynechococcus vulcanus [TaxId: 32053]}
tltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqea
efvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftvk
nlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeela
ranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyasi
ep
Timeline for d3a0ho_: