Lineage for d1efrb2 (1efr B:24-94)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 168781Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
  4. 168782Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 168783Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein)
  6. 168784Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species)
  7. 168788Species Cow (Bos taurus) [TaxId:9913] [50618] (9 PDB entries)
  8. 168826Domain d1efrb2: 1efr B:24-94 [26465]
    Other proteins in same PDB: d1efra1, d1efra3, d1efrb1, d1efrb3, d1efrc1, d1efrc3, d1efrd1, d1efrd3, d1efre1, d1efre3, d1efrf1, d1efrf3, d1efrg_

Details for d1efrb2

PDB Entry: 1efr (more details), 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the peptide antibiotic efrapeptin

SCOP Domain Sequences for d1efrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efrb2 b.49.1.1 (B:24-94) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik
egdivkrtgai

SCOP Domain Coordinates for d1efrb2:

Click to download the PDB-style file with coordinates for d1efrb2.
(The format of our PDB-style files is described here.)

Timeline for d1efrb2: