Lineage for d3a0hi_ (3a0h I:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254921Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) (S)
    automatically mapped to Pfam PF02532
  5. 2254922Family f.23.37.1: PsbI-like [161042] (1 protein)
    Pfam PF02532
  6. 2254923Protein Photosystem II reaction center protein I, PsbI [161043] (3 species)
  7. 2254934Species Thermosynechococcus vulcanus [TaxId:32053] [224950] (10 PDB entries)
  8. 2254944Domain d3a0hi_: 3a0h I: [264647]
    Other proteins in same PDB: d3a0ha_, d3a0hb_, d3a0hc_, d3a0hd_, d3a0he_, d3a0hf_, d3a0hh_, d3a0hj_, d3a0hk_, d3a0hl_, d3a0hm_, d3a0hn_, d3a0ho_, d3a0ht_, d3a0hu_, d3a0hv_, d3a0hx_, d3a0hy_, d3a0hz_
    complexed with bcr, cla, dgd, fe2, hem, iod, lhg, mge, oec, pho, pq9

Details for d3a0hi_

PDB Entry: 3a0h (more details), 4 Å

PDB Description: Crystal structure of I-substituted Photosystem II complex
PDB Compounds: (I:) Photosystem II reaction center protein I

SCOPe Domain Sequences for d3a0hi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a0hi_ f.23.37.1 (I:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus vulcanus [TaxId: 32053]}
metlkitvyivvtffvllfvfgflsgdparnpkrk

SCOPe Domain Coordinates for d3a0hi_:

Click to download the PDB-style file with coordinates for d3a0hi_.
(The format of our PDB-style files is described here.)

Timeline for d3a0hi_: