![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) ![]() automatically mapped to Pfam PF02532 |
![]() | Family f.23.37.1: PsbI-like [161042] (1 protein) Pfam PF02532 |
![]() | Protein Photosystem II reaction center protein I, PsbI [161043] (3 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [224950] (10 PDB entries) |
![]() | Domain d3a0hi_: 3a0h I: [264647] Other proteins in same PDB: d3a0ha_, d3a0hb_, d3a0hc_, d3a0hd_, d3a0he_, d3a0hf_, d3a0hh_, d3a0hj_, d3a0hk_, d3a0hl_, d3a0hm_, d3a0hn_, d3a0ho_, d3a0ht_, d3a0hu_, d3a0hv_, d3a0hx_, d3a0hy_, d3a0hz_ complexed with bcr, cla, dgd, fe2, hem, iod, lhg, mge, oec, pho, pq9 |
PDB Entry: 3a0h (more details), 4 Å
SCOPe Domain Sequences for d3a0hi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a0hi_ f.23.37.1 (I:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus vulcanus [TaxId: 32053]} metlkitvyivvtffvllfvfgflsgdparnpkrk
Timeline for d3a0hi_: