SCOPe 2.07: Domain d3a0hh_: 3a0h H:

Lineage for d3a0hh_ (3a0h H:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families)
   automatically mapped to Pfam PF00737

5. Family f.23.33.1: PsbH-like [161026] (2 proteins)
   Pfam PF00737

6. Protein Photosystem II reaction center protein H, PsbH [161027] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [267726] (20 PDB entries)

8. Domain d3a0hh_: 3a0h H: [264646]
   Other proteins in same PDB: d3a0ha_, d3a0hb_, d3a0hc_, d3a0hd_, d3a0he_, d3a0hf_, d3a0hi_, d3a0hj_, d3a0hk_, d3a0hl_, d3a0hm_, d3a0hn_, d3a0ho_, d3a0ht_, d3a0hu_, d3a0hv_, d3a0hx_, d3a0hy_, d3a0hz_
   complexed with bcr, cla, dgd, fe2, hem, iod, lhg, mge, oec, pho, pq9

Details for d3a0hh_

PDB Entry: 3a0h, 4 Å

PDB Description: Crystal structure of I-substituted Photosystem II complex

PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d3a0hh_:

Sequence; same for both SEQRES and ATOM records:

>d3a0hh_ f.23.33.1 (H:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus vulcanus [TaxId: 32053]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wkal

Timeline for d3a0hh_:

• d3a0hh_ first appeared in SCOPe 2.05
  
• d3a0hh_ appears in SCOPe 2.06
  
• d3a0hh_ appears in the current release, SCOPe 2.08