Lineage for d3a0hf_ (3a0h F:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2632073Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 2632074Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 2632107Protein Cytochrome b559 subunit beta, PsbF [161049] (2 species)
  7. 2632114Species Thermosynechococcus vulcanus [TaxId:32053] [267725] (12 PDB entries)
  8. 2632126Domain d3a0hf_: 3a0h F: [264645]
    Other proteins in same PDB: d3a0ha_, d3a0hb_, d3a0hc_, d3a0hd_, d3a0he_, d3a0hh_, d3a0hi_, d3a0hj_, d3a0hk_, d3a0hl_, d3a0hm_, d3a0hn_, d3a0ho_, d3a0ht_, d3a0hu_, d3a0hv_, d3a0hx_, d3a0hy_, d3a0hz_
    complexed with bcr, cla, dgd, fe2, hem, iod, lhg, mge, oec, pho, pq9

Details for d3a0hf_

PDB Entry: 3a0h (more details), 4 Å

PDB Description: Crystal structure of I-substituted Photosystem II complex
PDB Compounds: (F:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d3a0hf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a0hf_ f.23.38.1 (F:) Cytochrome b559 subunit beta, PsbF {Thermosynechococcus vulcanus [TaxId: 32053]}
vsypiftvrwvavhtlavptifflgaiaamqfiqr

SCOPe Domain Coordinates for d3a0hf_:

Click to download the PDB-style file with coordinates for d3a0hf_.
(The format of our PDB-style files is described here.)

Timeline for d3a0hf_: