Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily) 6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops |
Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) automatically mapped to Pfam PF00421 |
Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins) Pfam PF00421 |
Protein Photosystem II CP43 protein PsbC [161081] (2 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [267723] (1 PDB entry) |
Domain d3a0hc_: 3a0h C: [264642] Other proteins in same PDB: d3a0ha_, d3a0hb_, d3a0hd_, d3a0he_, d3a0hf_, d3a0hh_, d3a0hi_, d3a0hj_, d3a0hk_, d3a0hl_, d3a0hm_, d3a0hn_, d3a0ho_, d3a0ht_, d3a0hu_, d3a0hv_, d3a0hx_, d3a0hy_, d3a0hz_ complexed with bcr, cla, dgd, fe2, hem, iod, lhg, mge, oec, pho, pq9 |
PDB Entry: 3a0h (more details), 4 Å
SCOPe Domain Sequences for d3a0hc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a0hc_ f.55.1.1 (C:) Photosystem II CP43 protein PsbC {Thermosynechococcus vulcanus [TaxId: 32053]} dqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmyeqgl iliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetleeyssf fgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnptldp rvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarrafiw sgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdqklga nvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikndiqp wqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghlwhag raraaaagfekgidresepvlsmpsld
Timeline for d3a0hc_: