Lineage for d3a0hc_ (3a0h C:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028864Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
    6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops
  4. 3028865Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) (S)
    automatically mapped to Pfam PF00421
  5. 3028866Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
    Pfam PF00421
  6. 3028878Protein Photosystem II CP43 protein PsbC [161081] (2 species)
  7. 3028883Species Thermosynechococcus vulcanus [TaxId:32053] [267723] (1 PDB entry)
  8. 3028884Domain d3a0hc_: 3a0h C: [264642]
    Other proteins in same PDB: d3a0ha_, d3a0hb_, d3a0hd_, d3a0he_, d3a0hf_, d3a0hh_, d3a0hi_, d3a0hj_, d3a0hk_, d3a0hl_, d3a0hm_, d3a0hn_, d3a0ho_, d3a0ht_, d3a0hu_, d3a0hv_, d3a0hx_, d3a0hy_, d3a0hz_
    complexed with bcr, cla, dgd, fe2, hem, iod, lhg, mge, oec, pho, pq9

Details for d3a0hc_

PDB Entry: 3a0h (more details), 4 Å

PDB Description: Crystal structure of I-substituted Photosystem II complex
PDB Compounds: (C:) Photosystem II CP43 protein

SCOPe Domain Sequences for d3a0hc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a0hc_ f.55.1.1 (C:) Photosystem II CP43 protein PsbC {Thermosynechococcus vulcanus [TaxId: 32053]}
dqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmyeqgl
iliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetleeyssf
fgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnptldp
rvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarrafiw
sgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdqklga
nvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikndiqp
wqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghlwhag
raraaaagfekgidresepvlsmpsld

SCOPe Domain Coordinates for d3a0hc_:

Click to download the PDB-style file with coordinates for d3a0hc_.
(The format of our PDB-style files is described here.)

Timeline for d3a0hc_: