SCOPe 2.08: Domain d3a0hc_: 3a0h C:

Lineage for d3a0hc_ (3a0h C:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
   6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops

4. Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family)
   automatically mapped to Pfam PF00421

5. Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
   Pfam PF00421

6. Protein Photosystem II CP43 protein PsbC [161081] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [267723] (1 PDB entry)

8. Domain d3a0hc_: 3a0h C: [264642]
   Other proteins in same PDB: d3a0ha_, d3a0hb_, d3a0hd_, d3a0he_, d3a0hf_, d3a0hh_, d3a0hi_, d3a0hj_, d3a0hk_, d3a0hl_, d3a0hm_, d3a0hn_, d3a0ho_, d3a0ht_, d3a0hu_, d3a0hv_, d3a0hx_, d3a0hy_, d3a0hz_
   complexed with bcr, cla, dgd, fe2, hem, iod, lhg, mge, oec, pho, pq9

Details for d3a0hc_

PDB Entry: 3a0h, 4 Å

PDB Description: Crystal structure of I-substituted Photosystem II complex

PDB Compounds: (C:) Photosystem II CP43 protein

SCOPe Domain Sequences for d3a0hc_:

Sequence; same for both SEQRES and ATOM records:

>d3a0hc_ f.55.1.1 (C:) Photosystem II CP43 protein PsbC {Thermosynechococcus vulcanus [TaxId: 32053]}
dqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmyeqgl
iliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetleeyssf
fgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnptldp
rvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarrafiw
sgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdqklga
nvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikndiqp
wqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghlwhag
raraaaagfekgidresepvlsmpsld

Timeline for d3a0hc_:

• d3a0hc_ first appeared in SCOPe 2.05
  
• d3a0hc_ appears in SCOPe 2.07