Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein Photosystem Q(B) protein 1, PsbA1 [161053] (2 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [196646] (5 PDB entries) |
Domain d3a0ha_: 3a0h A: [264640] Other proteins in same PDB: d3a0hb_, d3a0hc_, d3a0hd_, d3a0he_, d3a0hf_, d3a0hh_, d3a0hi_, d3a0hj_, d3a0hk_, d3a0hl_, d3a0hm_, d3a0hn_, d3a0ho_, d3a0ht_, d3a0hu_, d3a0hv_, d3a0hx_, d3a0hy_, d3a0hz_ complexed with bcr, cla, dgd, fe2, hem, iod, lhg, mge, oec, pho, pq9 |
PDB Entry: 3a0h (more details), 4 Å
SCOPe Domain Sequences for d3a0ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a0ha_ f.26.1.1 (A:) Photosystem Q(B) protein 1, PsbA1 {Thermosynechococcus vulcanus [TaxId: 32053]} sanlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsg sllygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgr qwelsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqae hnilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetyniv aahgyfgrlifqyasfnnsrslhfflaawrvvgvwfaalgistmafnlngfnfnhsvida kgnvintwadiinranlgmevmhernahnfpldla
Timeline for d3a0ha_: