Lineage for d3a0ha_ (3a0h A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027491Protein Photosystem Q(B) protein 1, PsbA1 [161053] (2 species)
  7. 3027496Species Thermosynechococcus vulcanus [TaxId:32053] [196646] (5 PDB entries)
  8. 3027501Domain d3a0ha_: 3a0h A: [264640]
    Other proteins in same PDB: d3a0hb_, d3a0hc_, d3a0hd_, d3a0he_, d3a0hf_, d3a0hh_, d3a0hi_, d3a0hj_, d3a0hk_, d3a0hl_, d3a0hm_, d3a0hn_, d3a0ho_, d3a0ht_, d3a0hu_, d3a0hv_, d3a0hx_, d3a0hy_, d3a0hz_
    complexed with bcr, cla, dgd, fe2, hem, iod, lhg, mge, oec, pho, pq9

Details for d3a0ha_

PDB Entry: 3a0h (more details), 4 Å

PDB Description: Crystal structure of I-substituted Photosystem II complex
PDB Compounds: (A:) Photosystem Q(B) protein

SCOPe Domain Sequences for d3a0ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a0ha_ f.26.1.1 (A:) Photosystem Q(B) protein 1, PsbA1 {Thermosynechococcus vulcanus [TaxId: 32053]}
sanlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsg
sllygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgr
qwelsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqae
hnilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetyniv
aahgyfgrlifqyasfnnsrslhfflaawrvvgvwfaalgistmafnlngfnfnhsvida
kgnvintwadiinranlgmevmhernahnfpldla

SCOPe Domain Coordinates for d3a0ha_:

Click to download the PDB-style file with coordinates for d3a0ha_.
(The format of our PDB-style files is described here.)

Timeline for d3a0ha_: