SCOPe 2.06: Domain d1efra2: 1efr A:24-94

Lineage for d1efra2 (1efr A:24-94)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
   6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)

6. Protein F1 ATP synthase alpha subunit, domain 1 [88672] (5 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88673] (15 PDB entries)
   Uniprot P19483

8. Domain d1efra2: 1efr A:24-94 [26464]
   Other proteins in same PDB: d1efra1, d1efra3, d1efrb1, d1efrb3, d1efrc1, d1efrc3, d1efrd1, d1efrd2, d1efrd3, d1efre1, d1efre2, d1efre3, d1efrf1, d1efrf2, d1efrf3, d1efrg_
   complexed with adp, anp, mg

Details for d1efra2

PDB Entry: 1efr, 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the peptide antibiotic efrapeptin

PDB Compounds: (A:) bovine mitochondrial f1-ATPase subunit alpha

SCOPe Domain Sequences for d1efra2:

Sequence; same for both SEQRES and ATOM records:

>d1efra2 b.49.1.1 (A:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik
egdivkrtgai

Timeline for d1efra2:

• d1efra2 first appeared (with stable ids) in SCOP 1.55
  
• d1efra2 appears in SCOPe 2.05
  
• d1efra2 appears in SCOPe 2.07
  
• d1efra2 appears in the current release, SCOPe 2.08