Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
Protein automated matches [226927] (20 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [267817] (1 PDB entry) |
Domain d2z69c_: 2z69 C: [264630] Other proteins in same PDB: d2z69a2 automated match to d2pqqa_ |
PDB Entry: 2z69 (more details), 2.1 Å
SCOPe Domain Sequences for d2z69c_:
Sequence, based on SEQRES records: (download)
>d2z69c_ b.82.3.0 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} hqqllqshhlfeplspvqlqellassdlvnldkgayvfrqgepahafyylisgcvkiyrl tpegqekilevtnerntfaeammfmdtpnyvataqavvpsqlfrfsnkaylrqlqdntpl alallaklstrlhqrideietlsl
>d2z69c_ b.82.3.0 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} hqqllqshhlfeplspvqlqellassdlvnldkgayvfrqgepahafyylisgcvkiyrl qekilevtnerntfaeammfmdtpnyvataqavvpsqlfrfsnkaylrqlqdntplalal laklstrlhqreietlsl
Timeline for d2z69c_: