Class b: All beta proteins [48724] (111 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies) |
Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) |
Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein) |
Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [50618] (9 PDB entries) |
Domain d1e1qf2: 1e1q F:9-81 [26463] Other proteins in same PDB: d1e1qa1, d1e1qa3, d1e1qb1, d1e1qb3, d1e1qc1, d1e1qc3, d1e1qd1, d1e1qd3, d1e1qe1, d1e1qe3, d1e1qf1, d1e1qf3, d1e1qg_ |
PDB Entry: 1e1q (more details), 2.61 Å
SCOP Domain Sequences for d1e1qf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e1qf2 b.49.1.1 (F:9-81) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)} ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg lvrgqkvldsgap
Timeline for d1e1qf2: