Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (98 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267816] (3 PDB entries) |
Domain d2z1zb_: 2z1z B: [264627] automated match to d4my5a_ complexed with mlt, plp |
PDB Entry: 2z1z (more details), 2.4 Å
SCOPe Domain Sequences for d2z1zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z1zb_ c.67.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} eyktkvsrnsnmsklqagylfpeiarrrsahllkypdaqvislgigdttepipevitsam akkahelstiegysgygaeqgakplraaiaktfygglgigdddvfvsdgakcdisrlqvm fgsnvtiavqdpsypayvdssvimgqtgqfntdvqkygnieymrctpengffpdlstvgr tdiiffcspnnptgaaatreqltqlvefakkngsiivydsayamymsddnprsifeipga eevametasfskyagftgvrlgwtvipkkllysdgfpvakdfnriictcfngasnisqag alacltpegleamhkvigfykentniiidtftslgydvyggknapyvwvhfpnqsswdvf aeilekthvvttpgsgfgpggegfvrvsafghrenileacrrfkqlyk
Timeline for d2z1zb_: