Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (203 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186944] (39 PDB entries) |
Domain d2ydxb_: 2ydx B: [264613] automated match to d4ndne_ complexed with ca, nap, so4, stl, txp |
PDB Entry: 2ydx (more details), 2.8 Å
SCOPe Domain Sequences for d2ydxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ydxb_ c.2.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mnrrvlvtgatgllgravhkefqqnnwhavgcgfrrarpkfeqvnlldsnavhhiihdfq phvivhcaaerrpdvvenqpdaasqlnvdasgnlakeaaavgafliyissdyvfdgtnpp yreedipaplnlygktkldgekavlennlgaavlripilygevekleesavtvmfdkvqf snksanmdhwqqrfpthvkdvatvcrqlaekrmldpsikgtfhwsgneqmtkyemacaia dafnlpsshlrpitdspvlgaqrprnaqldcskletlgigqrtpfrigikeslwpflidk rwrqtvfhaenl
Timeline for d2ydxb_:
View in 3D Domains from other chains: (mouse over for more information) d2ydxa_, d2ydxc_, d2ydxd_, d2ydxe_ |