Lineage for d2ydxb_ (2ydx B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1831330Species Human (Homo sapiens) [TaxId:9606] [186944] (39 PDB entries)
  8. 1831392Domain d2ydxb_: 2ydx B: [264613]
    automated match to d4ndne_
    complexed with ca, nap, so4, stl, txp

Details for d2ydxb_

PDB Entry: 2ydx (more details), 2.8 Å

PDB Description: crystal structure of human s-adenosylmethionine synthetase 2, beta subunit
PDB Compounds: (B:) methionine adenosyltransferase 2 subunit beta

SCOPe Domain Sequences for d2ydxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ydxb_ c.2.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mnrrvlvtgatgllgravhkefqqnnwhavgcgfrrarpkfeqvnlldsnavhhiihdfq
phvivhcaaerrpdvvenqpdaasqlnvdasgnlakeaaavgafliyissdyvfdgtnpp
yreedipaplnlygktkldgekavlennlgaavlripilygevekleesavtvmfdkvqf
snksanmdhwqqrfpthvkdvatvcrqlaekrmldpsikgtfhwsgneqmtkyemacaia
dafnlpsshlrpitdspvlgaqrprnaqldcskletlgigqrtpfrigikeslwpflidk
rwrqtvfhaenl

SCOPe Domain Coordinates for d2ydxb_:

Click to download the PDB-style file with coordinates for d2ydxb_.
(The format of our PDB-style files is described here.)

Timeline for d2ydxb_: