Lineage for d2yd7b2 (2yd7 B:115-220)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754761Domain d2yd7b2: 2yd7 B:115-220 [264611]
    automated match to d2yd3a2
    complexed with po4

Details for d2yd7b2

PDB Entry: 2yd7 (more details), 1.98 Å

PDB Description: crystal structure of the n-terminal ig1-2 module of human receptor protein tyrosine phosphatase delta
PDB Compounds: (B:) ptprd protein

SCOPe Domain Sequences for d2yd7b2:

Sequence, based on SEQRES records: (download)

>d2yd7b2 b.1.1.0 (B:115-220) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlredqiprgfptidmgpqlkvvertrtatmlcaasgnpdpeitwfkdflpvdtsnnngr
ikqlrsesigalqieqseesdqgkyecvatnsagtrysapanlyvr

Sequence, based on observed residues (ATOM records): (download)

>d2yd7b2 b.1.1.0 (B:115-220) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlredqiprgfptidmgpqlkvvertrtatmlcaasgnpdpeitwfkdflpvdtrikqlr
sesigalqieqseesdqgkyecvatnsagtrysapanlyvr

SCOPe Domain Coordinates for d2yd7b2:

Click to download the PDB-style file with coordinates for d2yd7b2.
(The format of our PDB-style files is described here.)

Timeline for d2yd7b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2yd7b1