Lineage for d2yd6a1 (2yd6 A:21-114)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765217Domain d2yd6a1: 2yd6 A:21-114 [264606]
    automated match to d2yd3a1
    complexed with cl, flc

Details for d2yd6a1

PDB Entry: 2yd6 (more details), 1.35 Å

PDB Description: crystal structure of the n-terminal ig1-2 module of human receptor protein tyrosine phosphatase delta
PDB Compounds: (A:) ptprd protein

SCOPe Domain Sequences for d2yd6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yd6a1 b.1.1.0 (A:21-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
etpprftrtpvdqtgvsggvasficqatgdprpkivwnkkgkkvsnqrfeviefddgsgs
vlriqplrtprdeaiyecvasnnvgeisvstrlt

SCOPe Domain Coordinates for d2yd6a1:

Click to download the PDB-style file with coordinates for d2yd6a1.
(The format of our PDB-style files is described here.)

Timeline for d2yd6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2yd6a2