Lineage for d2yd2a1 (2yd2 A:30-123)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2366789Domain d2yd2a1: 2yd2 A:30-123 [264602]
    automated match to d2yd3a1
    complexed with cl, iod

Details for d2yd2a1

PDB Entry: 2yd2 (more details), 2.55 Å

PDB Description: crystal structure of the n-terminal ig1-2 module of human receptor protein tyrosine phosphatase sigma
PDB Compounds: (A:) Receptor-type tyrosine-protein phosphatase S

SCOPe Domain Sequences for d2yd2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yd2a1 b.1.1.0 (A:30-123) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eepprfikepkdqigvsggvasfvcqatgdpkprvtwnkkgkkvnsqrfetiefdesaga
vlriqplrtprdenvyecvaqnsvgeitvhaklt

SCOPe Domain Coordinates for d2yd2a1:

Click to download the PDB-style file with coordinates for d2yd2a1.
(The format of our PDB-style files is described here.)

Timeline for d2yd2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2yd2a2