Lineage for d1e1qa2 (1e1q A:24-94)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1795771Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 1795772Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families) (S)
    automatically mapped to Pfam PF02874
  5. 1795773Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 1795774Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species)
  7. 1795777Species Cow (Bos taurus) [TaxId:9913] [88673] (15 PDB entries)
    Uniprot P19483
  8. 1795808Domain d1e1qa2: 1e1q A:24-94 [26458]
    Other proteins in same PDB: d1e1qa1, d1e1qa3, d1e1qb1, d1e1qb3, d1e1qc1, d1e1qc3, d1e1qd1, d1e1qd2, d1e1qd3, d1e1qe1, d1e1qe2, d1e1qe3, d1e1qf1, d1e1qf2, d1e1qf3, d1e1qg_
    complexed with adp, anp, mg, po4

Details for d1e1qa2

PDB Entry: 1e1q (more details), 2.61 Å

PDB Description: bovine mitochondrial f1-atpase at 100k
PDB Compounds: (A:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1e1qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1qa2 b.49.1.1 (A:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik
egdivkrtgai

SCOPe Domain Coordinates for d1e1qa2:

Click to download the PDB-style file with coordinates for d1e1qa2.
(The format of our PDB-style files is described here.)

Timeline for d1e1qa2: