SCOPe 2.05: Domain d1nbmf2: 1nbm F:9-81

Lineage for d1nbmf2 (1nbm F:9-81)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
   6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)

6. Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88678] (18 PDB entries)
   Uniprot P00829

8. Domain d1nbmf2: 1nbm F:9-81 [26457]
   Other proteins in same PDB: d1nbma1, d1nbma2, d1nbma3, d1nbmb1, d1nbmb2, d1nbmb3, d1nbmc1, d1nbmc2, d1nbmc3, d1nbmd1, d1nbmd3, d1nbme1, d1nbme3, d1nbmf1, d1nbmf3, d1nbmg_
   complexed with adp, atp, mg, po4

Details for d1nbmf2

PDB Entry: 1nbm, 3 Å

PDB Description: the structure of bovine f1-atpase covalently inhibited with 4-chloro-7-nitrobenzofurazan

PDB Compounds: (F:) f1-ATPase

SCOPe Domain Sequences for d1nbmf2:

Sequence; same for both SEQRES and ATOM records:

>d1nbmf2 b.49.1.1 (F:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

Timeline for d1nbmf2:

• d1nbmf2 first appeared (with stable ids) in SCOP 1.55
  
• d1nbmf2 appears in SCOPe 2.04
  
• d1nbmf2 appears in SCOPe 2.06
  
• d1nbmf2 appears in the current release, SCOPe 2.08