Lineage for d1nbmf2 (1nbm F:9-81)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 61155Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
  4. 61156Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 61157Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein)
  6. 61158Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species)
  7. 61162Species Cow (Bos taurus) [TaxId:9913] [50618] (9 PDB entries)
  8. 61198Domain d1nbmf2: 1nbm F:9-81 [26457]
    Other proteins in same PDB: d1nbma1, d1nbma3, d1nbmb1, d1nbmb3, d1nbmc1, d1nbmc3, d1nbmd1, d1nbmd3, d1nbme1, d1nbme3, d1nbmf1, d1nbmf3, d1nbmg_

Details for d1nbmf2

PDB Entry: 1nbm (more details), 3 Å

PDB Description: the structure of bovine f1-atpase covalently inhibited with 4-chloro-7-nitrobenzofurazan

SCOP Domain Sequences for d1nbmf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbmf2 b.49.1.1 (F:9-81) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

SCOP Domain Coordinates for d1nbmf2:

Click to download the PDB-style file with coordinates for d1nbmf2.
(The format of our PDB-style files is described here.)

Timeline for d1nbmf2: